SKU: 50248990921

HRSV Glycoprotein G (Strain A2), His tag

Sale price$121.50 Regular price$135.00
Save 10%

Pay in installments of $33.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 15 - Jul 20

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

HRSV Glycoprotein G (Strain A2), His tagProduct Specification Species HRSV Synonyms Major surface glycoprotein G, Attachment glycoprotein G, Membrane bound glycoprotein (mG) Accession P03423 Amino Acid Sequence Protein sequence(P03423, Ser64 Gln298, with C 10*His)

Product Specification


Species HRSV
Synonyms Major surface glycoprotein G, Attachment glycoprotein G, Membrane-bound glycoprotein (mG)
Accession P03423
Amino Acid Sequence Protein sequence(P03423, Ser64-Gln298, with C-10*His) SANHKVTPTTAIIQDATSQIKNTTPTYLTQNPQLGISPSNPSEITSQITTILASTTPGVKSTLQSTTVKTKNTTTTQTQPSKPTTKQRQNKPPSKPNNDFHFEVFNFVPCSICSNNPTCWAICKRIPNKKPGKKTTTKPTKKPTLKTTKKDPKPQTTKSKEVPTTKPTEEPTINTTKTNIITTLLTSNTTGNPELTSQMETFHSTSSEGNPSPSQVSTTSEYPSQPSSPPNTPRQGGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight Theoretical:27.2kDa Actual:45-110kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Respiratory syncytial virus G protein is a protein produced by respiratory syncytial virus. The viral G protein is a highly glycosylated 90 kDa transmembrane protein, primarily responsible for the attachment of RSV to the host cell. Though not required for the production of infectious RSV or virus-like particles, RSV G is necessary for full infectivity and is found on the membrane of mature filaments. Additionally, RSV G interacts with both RSV M and F protein, which appears to be required for complete virion assembly.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 50248990921

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 9 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
ali
West Palm Beach, US
★★★★★ 5
Good ball for strong chewers
Color: Cheeze Brawl - Large, Color: Cheeze Brawl - Large
My dog loves this ball except the outside fur gets gross really quickly. However, it’s easy to cutoff and underneath is a strong squeaky ball. It’s like two gifts in one. He’s a very heavy chewer and the ball lasts quite a bit.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 31, 2025
A
Verified Purchase
Ashton Gibson
Houston, US
★★★★★ 5
Take the skin off and get the right size for your dog’s weight!
Color: Panda Bear - Large, Color: Panda Bear - Large
This review is specifically for the panda toy. My dog is a super chewer and will literally go through any normal toy, even the ones labeled for aggressive chewers, within a few hours at most. He’s about to be 10 years old and this is the first time he’s ever had a toy that lasted as long as it has. I wanna mention the outer layer he almost immediately chewed through. To me, it wasn’t worth the fear of him dealing through pieces so I just took the whole “skin” off. However, he’s safely had this for 2 months with no issues and heavy daily chewing until he finally broke it apart. So if you have a super chewer, make sure to get the size appropriate for your dog’s weight and take the “skin” off and you’re left with a quality toy that will stick around! Pictured is a set of 2 new toys of the same variety since he finally chewed through his last batch lol
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
K
Verified Purchase
Kit
Houston, US
★★★★★ 4
My dog loves this toy but…
Color: Grey Bear - Large
This toy has many pros and cons, but it’s my dogs all time favorite toy so I have to give it 4 stars. Pro:My German Shepard loves this toy, it has no squeaker and she hates squeakers, so she hasn’t tried to destroy it. It’s the perfect size for a large ball. She likes to throw her toys and this one has a pretty decent bounce to it so she can entertain herself. Cons: the inside is hard rubber, she likes to throw her toys and it hurts when she hits you with it or drops it on your feet. Also a huge hazard to windows and anything breakable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 12, 2025
I
Verified Purchase
ingrid C
Cuba, US
★★★★★ 5
Pretty awesome chew toy
Color: Grey Bear - Large
This toy is great!! I have a doodle that shreds everything in sight, including durable toys, but this one stood up to the Teddy test! He easily ripped off the ear/feet bits, but the fabric casing hasn’t come off after a week of play, and I expect the rubber toy inside will be even harder to break. This is a fairly heavy toy, so it makes a thunk when it drops and is probably not suitable for small dogs. It has a light squeak that is quiet and infrequent enough to not annoy me, and it’s pretty cute too!! it does get soaked in drool pretty fast (and takes forever to dry), but at this point i’m grateful it lasts long enough to get drooled on at all.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 30, 2025
A
Verified Purchase
a b
Natrona Heights, US
★★★★★ 3
less than 24 hours :/
Color: Grey Bear - Large, Color: Grey Bear - Large
smaller than i expected but had a strong interior that i was pleasantly surprised with. my lil lady very much enjoyed it, however it lasted less than 24 hours before the poor toy was skinned alive :( she loves plushies and she’s obsessed w his skin after tearing him apart. it does have a solid rubber interior that is still good as a toy, however i was hoping its skin would stay on longer than a day :( overall decent toy, 3 stars for being destroyed so quickly. wouldn’t recommend for strong chewers
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 7, 2025

recommand products